Lineage for d5heif1 (5hei F:1-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963381Protein automated matches [190153] (5 species)
    not a true protein
  7. 2963382Species Bacillus megaterium [TaxId:1404] [314651] (1 PDB entry)
  8. 2963388Domain d5heif1: 5hei F:1-245 [314661]
    Other proteins in same PDB: d5heia2, d5heib2, d5heic2, d5heid2, d5heie2, d5heif2, d5heig2, d5heih2
    automated match to d1zcha1
    complexed with fmn, mpd, so4

Details for d5heif1

PDB Entry: 5hei (more details), 2.84 Å

PDB Description: structure of b. megaterium nfra2
PDB Compounds: (F:) NfrA2

SCOPe Domain Sequences for d5heif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5heif1 d.90.1.1 (F:1-245) automated matches {Bacillus megaterium [TaxId: 1404]}
mneairtiqdhrsirqytdeavsdehldtiiqsaqsaassingqqvtiisvqdkekkkkl
selagnqawidqaplflifcadfnrakiaaelndaplgvtdglesilvgatdagisleaa
tvaaeslglgtvpiggirrkplevielldlpeyvfpvsglvvghpsdhsakkprlpqaav
hhresynhdlksliqdydaemaeymkkrtngaddrnwsqtvsaiyktiyypevramlekq
gfkfe

SCOPe Domain Coordinates for d5heif1:

Click to download the PDB-style file with coordinates for d5heif1.
(The format of our PDB-style files is described here.)

Timeline for d5heif1: