Lineage for d5hcva_ (5hcv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (157 PDB entries)
  8. 2336390Domain d5hcva_: 5hcv A: [314660]
    automated match to d2a3ia_
    complexed with 60r, cl

Details for d5hcva_

PDB Entry: 5hcv (more details), 2.5 Å

PDB Description: identification of spirooxindole and dibenzoxazepine motifs as potent mineralocorticoid receptor antagonists
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d5hcva_:

Sequence, based on SEQRES records: (download)

>d5hcva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpled
qitliqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqisl
qfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnnsgqs
wqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnak
plyfh

Sequence, based on observed residues (ATOM records): (download)

>d5hcva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvmvleniepeivyagypdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqitl
iqyswmslssfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqfvr
lqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvnsgqswqrfyqltk
lldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakplyfh

SCOPe Domain Coordinates for d5hcva_:

Click to download the PDB-style file with coordinates for d5hcva_.
(The format of our PDB-style files is described here.)

Timeline for d5hcva_: