Lineage for d5h88b_ (5h88 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547337Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries)
  8. 2547395Domain d5h88b_: 5h88 B: [314655]
    automated match to d3st2a_
    mutant

Details for d5h88b_

PDB Entry: 5h88 (more details), 2.06 Å

PDB Description: crystal structure of mrojoa mutant - t16v -p63f - w143a - l163v
PDB Compounds: (B:) mRojoA fluorescent protein

SCOPe Domain Sequences for d5h88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h88b_ d.22.1.1 (B:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
iikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilsfqfm
ygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklhg
tnfpsdgpvmqkktmgaeassermypedgalkgeikvrlklkdgghydaevkttykakkp
vqlpgaynanyklditshnedytiveqyercegrh

SCOPe Domain Coordinates for d5h88b_:

Click to download the PDB-style file with coordinates for d5h88b_.
(The format of our PDB-style files is described here.)

Timeline for d5h88b_: