Lineage for d5hd6h1 (5hd6 H:1-172)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187851Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2187862Protein automated matches [191220] (4 species)
    not a true protein
  7. 2187919Species Yersinia pestis [TaxId:214092] [280026] (2 PDB entries)
  8. 2187929Domain d5hd6h1: 5hd6 H:1-172 [314653]
    Other proteins in same PDB: d5hd6a2, d5hd6b2, d5hd6c2, d5hd6d2, d5hd6e2, d5hd6h2
    automated match to d1mkaa_
    complexed with gol

Details for d5hd6h1

PDB Entry: 5hd6 (more details), 1.35 Å

PDB Description: high resolution structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from yersinia pestis at 1.35 a
PDB Compounds: (H:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d5hd6h1:

Sequence, based on SEQRES records: (download)

>d5hd6h1 d.38.1.2 (H:1-172) automated matches {Yersinia pestis [TaxId: 214092]}
mvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeld
inpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlp
dakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnaf

Sequence, based on observed residues (ATOM records): (download)

>d5hd6h1 d.38.1.2 (H:1-172) automated matches {Yersinia pestis [TaxId: 214092]}
mvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeld
inpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlp
dakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtnf

SCOPe Domain Coordinates for d5hd6h1:

Click to download the PDB-style file with coordinates for d5hd6h1.
(The format of our PDB-style files is described here.)

Timeline for d5hd6h1: