SCOPe 2.08: Domain d5h8da1: 5h8d A:8-116

Lineage for d5h8da1 (5h8d A:8-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5h8da1: 5h8d A:8-116 [314649]
   Other proteins in same PDB: d5h8da2
   automated match to d1bzqk_

Details for d5h8da1

PDB Entry: 5h8d, 1.89 Å

PDB Description: crystal structure of an asc binding nanobody

PDB Compounds: (A:) VHH nanobody

SCOPe Domain Sequences for d5h8da1:

Sequence; same for both SEQRES and ATOM records:

>d5h8da1 b.1.1.1 (A:8-116) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslklscaasgftfsryamswyrqapgkeresvarissgggtiyyadsvk
grftisredakntvylqmnslkpedtavyycyvggfwgqgtqvtvssgg

Timeline for d5h8da1:

• d5h8da1 first appeared in SCOPe 2.06, called d5h8da_
  
• d5h8da1 appears in SCOPe 2.07