SCOPe 2.08: Domain d5fhbl1: 5fhb L:2-107

Lineage for d5fhbl1 (5fhb L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5fhbl1: 5fhb L:2-107 [314647]
   Other proteins in same PDB: d5fhbh1, d5fhbh2, d5fhbl2
   automated match to d1lila1
   complexed with act, edo

Details for d5fhbl1

PDB Entry: 5fhb, 1.97 Å

PDB Description: crystal structure of protective ebola virus antibody 100

PDB Compounds: (L:) Antibody 100 Fab light chain

SCOPe Domain Sequences for d5fhbl1:

Sequence; same for both SEQRES and ATOM records:

>d5fhbl1 b.1.1.1 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqplsvsvspgqtaiftcsgdnlgdkyvcwfqqrpgqspmlliyqdnkrpsgiperf
sgsnsgntatltisgtqstdeadyycqtwdstvvfgggtkltvlg

Timeline for d5fhbl1:

• d5fhbl1 first appeared in SCOPe 2.06
  
• d5fhbl1 appears in SCOPe 2.07