Lineage for d5hdba_ (5hdb A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399674Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2399675Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2399676Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2399677Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (23 PDB entries)
    Uniprot P08514 32-483
  8. 2399706Domain d5hdba_: 5hdb A: [314635]
    Other proteins in same PDB: d5hdbf1, d5hdbf2, d5hdbl1, d5hdbl2
    automated match to d3niga_
    complexed with 5yb, bma, ca, cl, gol, man, mg, nag, so4

Details for d5hdba_

PDB Entry: 5hdb (more details), 2.7 Å

PDB Description: integrin alphaiibbeta3 in complex with ro-435054
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d5hdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdba_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d5hdba_:

Click to download the PDB-style file with coordinates for d5hdba_.
(The format of our PDB-style files is described here.)

Timeline for d5hdba_: