SCOPe 2.08: Domain d5h9ma_: 5h9m A:

Lineage for d5h9ma_ (5h9m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
   automatically mapped to Pfam PF03145

6. Protein automated matches [190456] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries)

8. Domain d5h9ma_: 5h9m A: [314632]
   automated match to d4ca1a_
   complexed with 1pe, cl, unx, zn

Details for d5h9ma_

PDB Entry: 5h9m, 1.76 Å

PDB Description: crystal structure of siah2 sbd domain

PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH2

SCOPe Domain Sequences for d5h9ma_:

Sequence; same for both SEQRES and ATOM records:

>d5h9ma_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
savlfpckyattgcsltlhhtekpehediceyrpyscpcpgasckwqgsleavmshlmha
hksittlqgedivflatdinlpgavdwvmmqscfghhfmlvlekqekyeghqqffaivll
igtrkqaenfayrlelngnrrrltweatprsihdgvaaaimnsdclvfdtaiahlfadng
nlginvtist

Timeline for d5h9ma_:

• d5h9ma_ first appeared in SCOPe 2.06
  
• d5h9ma_ appears in SCOPe 2.07