Lineage for d5h86a1 (5h86 A:3-168)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209825Species Human (Homo sapiens) [TaxId:9606] [225745] (21 PDB entries)
  8. 2209858Domain d5h86a1: 5h86 A:3-168 [314630]
    Other proteins in same PDB: d5h86a2
    automated match to d5gcna_
    complexed with bco, edo

Details for d5h86a1

PDB Entry: 5h86 (more details), 2.08 Å

PDB Description: human gcn5 bound to butyryl-coa
PDB Compounds: (A:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5h86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h86a1 d.108.1.0 (A:3-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikd
grviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyade
yaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

SCOPe Domain Coordinates for d5h86a1:

Click to download the PDB-style file with coordinates for d5h86a1.
(The format of our PDB-style files is described here.)

Timeline for d5h86a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h86a2