Lineage for d5fv1w1 (5fv1 W:13-110)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638318Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2638395Protein automated matches [190290] (1 species)
    not a true protein
  7. 2638396Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 2638411Domain d5fv1w1: 5fv1 W:13-110 [314626]
    Other proteins in same PDB: d5fv1l_, d5fv1m_, d5fv1w2
    automated match to d4zffd_

Details for d5fv1w1

PDB Entry: 5fv1 (more details), 2.7 Å

PDB Description: crystal structure of hvegf in complex with vk domain antibody
PDB Compounds: (W:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d5fv1w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fv1w1 g.17.1.1 (W:13-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkdr

SCOPe Domain Coordinates for d5fv1w1:

Click to download the PDB-style file with coordinates for d5fv1w1.
(The format of our PDB-style files is described here.)

Timeline for d5fv1w1: