SCOPe 2.06: Domain d5fv1w1: 5fv1 W:13-110

Lineage for d5fv1w1 (5fv1 W:13-110)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)

8. Domain d5fv1w1: 5fv1 W:13-110 [314626]
   Other proteins in same PDB: d5fv1l_, d5fv1m_, d5fv1w2
   automated match to d4zffd_

Details for d5fv1w1

PDB Entry: 5fv1, 2.7 Å

PDB Description: crystal structure of hvegf in complex with vk domain antibody

PDB Compounds: (W:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d5fv1w1:

Sequence; same for both SEQRES and ATOM records:

>d5fv1w1 g.17.1.1 (W:13-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkdr

Timeline for d5fv1w1:

• d5fv1w1 is new in SCOPe 2.06-stable
  
• d5fv1w1 appears in SCOPe 2.07
  
• d5fv1w1 appears in the current release, SCOPe 2.08