Lineage for d5fooe_ (5foo E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419486Species Streptococcus pyogenes [TaxId:160490] [314579] (1 PDB entry)
  8. 2419491Domain d5fooe_: 5foo E: [314620]
    automated match to d4b3la_
    complexed with cl, edo, jaz, po4, trs

Details for d5fooe_

PDB Entry: 5foo (more details), 2.1 Å

PDB Description: 6-phospho-beta-glucosidase
PDB Compounds: (E:) 6-phospho-beta-d glycosidase

SCOPe Domain Sequences for d5fooe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fooe_ c.1.8.0 (E:) automated matches {Streptococcus pyogenes [TaxId: 160490]}
mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli

SCOPe Domain Coordinates for d5fooe_:

Click to download the PDB-style file with coordinates for d5fooe_.
(The format of our PDB-style files is described here.)

Timeline for d5fooe_: