| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
| Domain d5fv1m_: 5fv1 M: [314617] Other proteins in same PDB: d5fv1v_, d5fv1w1, d5fv1w2 automated match to d4n1ed_ |
PDB Entry: 5fv1 (more details), 2.7 Å
SCOPe Domain Sequences for d5fv1m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fv1m_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqwigpelkwyqqkpgkapklliyhgsilqsgvps
rfsgsgsgtdftltisslqpedfatyycqqymyyphtfgqgtkveik
Timeline for d5fv1m_:
View in 3DDomains from other chains: (mouse over for more information) d5fv1l_, d5fv1v_, d5fv1w1, d5fv1w2 |