Lineage for d5fv1m_ (5fv1 M:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024311Domain d5fv1m_: 5fv1 M: [314617]
    Other proteins in same PDB: d5fv1v_, d5fv1w1, d5fv1w2
    automated match to d4n1ed_

Details for d5fv1m_

PDB Entry: 5fv1 (more details), 2.7 Å

PDB Description: crystal structure of hvegf in complex with vk domain antibody
PDB Compounds: (M:) vk domain antibody

SCOPe Domain Sequences for d5fv1m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fv1m_ b.1.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqwigpelkwyqqkpgkapklliyhgsilqsgvps
rfsgsgsgtdftltisslqpedfatyycqqymyyphtfgqgtkveik

SCOPe Domain Coordinates for d5fv1m_:

Click to download the PDB-style file with coordinates for d5fv1m_.
(The format of our PDB-style files is described here.)

Timeline for d5fv1m_: