Lineage for d5fxla_ (5fxl A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066158Species Cow (Bos taurus) [TaxId:9913] [187001] (14 PDB entries)
  8. 2066169Domain d5fxla_: 5fxl A: [314611]
    automated match to d1tgsz_
    complexed with ben, ca, so4

Details for d5fxla_

PDB Entry: 5fxl (more details), 1.78 Å

PDB Description: structure of trypsin solved by mr from data collected by direct data collection (ddc) using the esrf robodiff goniometer
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d5fxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxla_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d5fxla_:

Click to download the PDB-style file with coordinates for d5fxla_.
(The format of our PDB-style files is described here.)

Timeline for d5fxla_: