Lineage for d5fv1v_ (5fv1 V:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260465Protein automated matches [190290] (1 species)
    not a true protein
  7. 2260466Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 2260480Domain d5fv1v_: 5fv1 V: [314604]
    Other proteins in same PDB: d5fv1l_, d5fv1m_, d5fv1w2
    automated match to d4zffd_

Details for d5fv1v_

PDB Entry: 5fv1 (more details), 2.7 Å

PDB Description: crystal structure of hvegf in complex with vk domain antibody
PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d5fv1v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fv1v_ g.17.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d5fv1v_:

Click to download the PDB-style file with coordinates for d5fv1v_.
(The format of our PDB-style files is described here.)

Timeline for d5fv1v_: