Lineage for d5fzob1 (5fzo B:2157-2498)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2405395Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2405396Protein automated matches [191281] (16 species)
    not a true protein
  7. 2405429Species Human (Homo sapiens) [TaxId:9606] [255708] (2 PDB entries)
  8. 2405431Domain d5fzob1: 5fzo B:2157-2498 [314589]
    Other proteins in same PDB: d5fzoa2, d5fzob2
    automated match to d4c8da_
    complexed with cl, edo, mn

Details for d5fzob1

PDB Entry: 5fzo (more details), 1.84 Å

PDB Description: crystal structure of the catalytic domain of human jmjd1c
PDB Compounds: (B:) probable jmjc domain-containing histone demethylation prot ein 2c

SCOPe Domain Sequences for d5fzob1:

Sequence, based on SEQRES records: (download)

>d5fzob1 b.82.2.0 (B:2157-2498) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg
dhqadllnckdsiisnanvkefwdgfeevskrqknksgetvvlklkdwpsgedfktmmpa
ryedllkslplpeycnpegkfnlashlpgffvrpdlgprlcsaygvvaakdhdigttnlh
ievddvvnilvyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyag
kdvdkireflqkiskeqglevlpehdpirdqswyvnkklrqrlleeygvrtctliqflgd
aivlpagalhqvqnfhsciqvtedfvspehlvesfhltqelr

Sequence, based on observed residues (ATOM records): (download)

>d5fzob1 b.82.2.0 (B:2157-2498) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iphswicekhilwlkdyknssnwklfkecwkqgqpavvsgvhkkmnislwkaesisldfg
dhqadllnckdsiisnanvkefwdgfeevskrqketvvlklkdwpsgedfktmmparyed
llkslplpeycnpegkfnlashlpgffvrpdlgprlcsaygvvaakdhdigttnlhievd
dvvnilvyvgiakgngilskagilkkfeeedlddilrkrlkdsseipgalwhiyagkdvd
kireflqkiskeqglevlpehdpirdqswyvnkklrqrlleeygvrtctliqflgdaivl
pagalhqvqnfhsciqvtedfvspehlvesfhltqelr

SCOPe Domain Coordinates for d5fzob1:

Click to download the PDB-style file with coordinates for d5fzob1.
(The format of our PDB-style files is described here.)

Timeline for d5fzob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fzob2