Lineage for d5ftkb1 (5ftk B:21-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2393919Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2393982Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2394127Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 protein domains)
  6. 2394128Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2394129Species Human (Homo sapiens) [TaxId:9606] [233316] (12 PDB entries)
  8. 2394147Domain d5ftkb1: 5ftk B:21-106 [314584]
    Other proteins in same PDB: d5ftka2, d5ftka3, d5ftka4, d5ftkb2, d5ftkb3, d5ftkb4, d5ftkc2, d5ftkc3, d5ftkc4, d5ftkd2, d5ftkd3, d5ftkd4, d5ftke2, d5ftke3, d5ftke4, d5ftkf2, d5ftkf3, d5ftkf4
    automated match to d3cf1a1
    complexed with adp

Details for d5ftkb1

PDB Entry: 5ftk (more details), 2.4 Å

PDB Description: cryo-em structure of human p97 bound to adp
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftkb1 b.52.2.3 (B:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
kirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5ftkb1:

Click to download the PDB-style file with coordinates for d5ftkb1.
(The format of our PDB-style files is described here.)

Timeline for d5ftkb1: