Lineage for d5ftjf4 (5ftj F:471-763)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871178Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2871179Species Human (Homo sapiens) [TaxId:9606] [313486] (5 PDB entries)
  8. 2871192Domain d5ftjf4: 5ftj F:471-763 [314568]
    Other proteins in same PDB: d5ftja1, d5ftja2, d5ftjb1, d5ftjb2, d5ftjc1, d5ftjc2, d5ftjd1, d5ftjd2, d5ftje1, d5ftje2, d5ftjf1, d5ftjf2
    automated match to d3cf1a3
    complexed with adp, oja

Details for d5ftjf4

PDB Entry: 5ftj (more details), 2.3 Å

PDB Description: cryo-em structure of human p97 bound to upcdc30245 inhibitor
PDB Compounds: (F:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftjf4:

Sequence, based on SEQRES records: (download)

>d5ftjf4 c.37.1.20 (F:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirre
rerqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq

Sequence, based on observed residues (ATOM records): (download)

>d5ftjf4 c.37.1.20 (F:471-763) Membrane fusion ATPase VCP/p97 {Human (Homo sapiens) [TaxId: 9606]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseivpe
irrdhfeeamrfarrsvsdndirkyemfaqtlq

SCOPe Domain Coordinates for d5ftjf4:

Click to download the PDB-style file with coordinates for d5ftjf4.
(The format of our PDB-style files is described here.)

Timeline for d5ftjf4: