Lineage for d5ftjf2 (5ftj F:107-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186568Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186569Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2186570Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2186585Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2186586Species Human (Homo sapiens) [TaxId:9606] [233318] (12 PDB entries)
  8. 2186601Domain d5ftjf2: 5ftj F:107-200 [314566]
    Other proteins in same PDB: d5ftja1, d5ftja3, d5ftja4, d5ftjb1, d5ftjb3, d5ftjb4, d5ftjc1, d5ftjc3, d5ftjc4, d5ftjd1, d5ftjd3, d5ftjd4, d5ftje1, d5ftje3, d5ftje4, d5ftjf1, d5ftjf3, d5ftjf4
    automated match to d3cf1a4
    complexed with adp, oja

Details for d5ftjf2

PDB Entry: 5ftj (more details), 2.3 Å

PDB Description: cryo-em structure of human p97 bound to upcdc30245 inhibitor
PDB Compounds: (F:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftjf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftjf2 d.31.1.1 (F:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d5ftjf2:

Click to download the PDB-style file with coordinates for d5ftjf2.
(The format of our PDB-style files is described here.)

Timeline for d5ftjf2: