![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries) |
![]() | Domain d5fhob_: 5fho B: [314561] Other proteins in same PDB: d5fhod2 automated match to d2xhda_ complexed with 5xn, cl, edo, gol, pg4, so4 |
PDB Entry: 5fho (more details), 2.3 Å
SCOPe Domain Sequences for d5fhob_:
Sequence, based on SEQRES records: (download)
>d5fhob_ c.94.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq glldklknkwwydkgecgs
>d5fhob_ c.94.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq glldklknkwwecgs
Timeline for d5fhob_:
![]() Domains from other chains: (mouse over for more information) d5fhoa_, d5fhoc_, d5fhod1, d5fhod2 |