Lineage for d5fqta_ (5fqt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (157 PDB entries)
  8. 2336292Domain d5fqta_: 5fqt A: [314558]
    automated match to d3uucd_
    complexed with 7qn

Details for d5fqta_

PDB Entry: 5fqt (more details), 2 Å

PDB Description: selective estrogen receptor downregulator antagonists: tetrahydroisoquinoline phenols 4.
PDB Compounds: (A:) Estrogen receptor alpha

SCOPe Domain Sequences for d5fqta_:

Sequence, based on SEQRES records: (download)

>d5fqta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld

Sequence, based on observed residues (ATOM records): (download)

>d5fqta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmak
agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld

SCOPe Domain Coordinates for d5fqta_:

Click to download the PDB-style file with coordinates for d5fqta_.
(The format of our PDB-style files is described here.)

Timeline for d5fqta_: