![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
![]() | Protein automated matches [279671] (1 species) not a true protein |
![]() | Species Sporosarcina pasteurii [TaxId:1474] [279673] (4 PDB entries) |
![]() | Domain d5fsea_: 5fse A: [314542] Other proteins in same PDB: d5fseb_ automated match to d5a6ta_ complexed with edo, hqe, ni, oh, so4 |
PDB Entry: 5fse (more details), 2.07 Å
SCOPe Domain Sequences for d5fsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fsea_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]} mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d5fsea_: