Lineage for d5ftkd2 (5ftk D:107-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942267Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942268Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2942269Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins)
  6. 2942284Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2942285Species Human (Homo sapiens) [TaxId:9606] [233318] (13 PDB entries)
  8. 2942305Domain d5ftkd2: 5ftk D:107-200 [314537]
    Other proteins in same PDB: d5ftka1, d5ftka3, d5ftka4, d5ftkb1, d5ftkb3, d5ftkb4, d5ftkc1, d5ftkc3, d5ftkc4, d5ftkd1, d5ftkd3, d5ftkd4, d5ftke1, d5ftke3, d5ftke4, d5ftkf1, d5ftkf3, d5ftkf4
    automated match to d3cf1a4
    complexed with adp

Details for d5ftkd2

PDB Entry: 5ftk (more details), 2.4 Å

PDB Description: cryo-em structure of human p97 bound to adp
PDB Compounds: (D:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5ftkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftkd2 d.31.1.1 (D:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d5ftkd2:

Click to download the PDB-style file with coordinates for d5ftkd2.
(The format of our PDB-style files is described here.)

Timeline for d5ftkd2: