Lineage for d5ftad_ (5fta D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945883Domain d5ftad_: 5fta D: [314522]
    automated match to d4uesa_
    complexed with hg

Details for d5ftad_

PDB Entry: 5fta (more details), 2.64 Å

PDB Description: crystal structure of the n-terminal btb domain of human kctd10
PDB Compounds: (D:) btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 3

SCOPe Domain Sequences for d5ftad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ftad_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyvklnvggalyyttmqtltkqdtmlkamlsgrmevltdsegwilidrcgkhfgtilnyl
rdgavplpesrreieellaeakyylvqglveecqaalqn

SCOPe Domain Coordinates for d5ftad_:

Click to download the PDB-style file with coordinates for d5ftad_.
(The format of our PDB-style files is described here.)

Timeline for d5ftad_: