Lineage for d5fuia_ (5fui A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775458Species Zobellia galactanivorans [TaxId:63186] [268251] (1 PDB entry)
  8. 2775459Domain d5fuia_: 5fui A: [314520]
    automated match to d4crra_
    complexed with apy, gol, mg

Details for d5fuia_

PDB Entry: 5fui (more details), 1.4 Å

PDB Description: crystal structure of the c-terminal cbm6 of lamc a marine laminarianse from zobellia galactanivorans
PDB Compounds: (A:) endo-1,3-beta-glucanase, family gh16

SCOPe Domain Sequences for d5fuia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuia_ b.18.1.0 (A:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
ntlkieaesylysndvqkepcseggenvgyinngswmsypginfpssgnylieyrvasav
dggrfssdleagetvlgelsvpntggwqnwttvsqtvnvsagtyqfglysisggwninwi
ritk

SCOPe Domain Coordinates for d5fuia_:

Click to download the PDB-style file with coordinates for d5fuia_.
(The format of our PDB-style files is described here.)

Timeline for d5fuia_: