Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Zobellia galactanivorans [TaxId:63186] [268251] (1 PDB entry) |
Domain d5fuia_: 5fui A: [314520] automated match to d4crra_ complexed with apy, gol, mg |
PDB Entry: 5fui (more details), 1.4 Å
SCOPe Domain Sequences for d5fuia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fuia_ b.18.1.0 (A:) automated matches {Zobellia galactanivorans [TaxId: 63186]} ntlkieaesylysndvqkepcseggenvgyinngswmsypginfpssgnylieyrvasav dggrfssdleagetvlgelsvpntggwqnwttvsqtvnvsagtyqfglysisggwninwi ritk
Timeline for d5fuia_: