SCOPe 2.06: Domain d5dclb_: 5dcl B:

Lineage for d5dclb_ (5dcl B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:1311] [313977] (1 PDB entry)

8. Domain d5dclb_: 5dcl B: [314517]
   automated match to d3gt7a_
   complexed with edo

Details for d5dclb_

PDB Entry: 5dcl, 1.41 Å

PDB Description: structure of a lantibiotic response regulator: n terminal domain of the nisin resistance regulator nsrr

PDB Compounds: (B:) PhoB family transcriptional regulator

SCOPe Domain Sequences for d5dclb_:

Sequence; same for both SEQRES and ATOM records:

>d5dclb_ c.23.1.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
eqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpyfng
fywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr

Timeline for d5dclb_:

• d5dclb_ is new in SCOPe 2.06-stable
  
• d5dclb_ appears in SCOPe 2.07
  
• d5dclb_ appears in the current release, SCOPe 2.08