Lineage for d5dclb_ (5dcl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856121Species Streptococcus agalactiae [TaxId:1311] [313977] (1 PDB entry)
  8. 2856123Domain d5dclb_: 5dcl B: [314517]
    automated match to d3gt7a_
    complexed with edo

Details for d5dclb_

PDB Entry: 5dcl (more details), 1.41 Å

PDB Description: structure of a lantibiotic response regulator: n terminal domain of the nisin resistance regulator nsrr
PDB Compounds: (B:) PhoB family transcriptional regulator

SCOPe Domain Sequences for d5dclb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dclb_ c.23.1.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
eqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpyfng
fywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr

SCOPe Domain Coordinates for d5dclb_:

Click to download the PDB-style file with coordinates for d5dclb_.
(The format of our PDB-style files is described here.)

Timeline for d5dclb_: