| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Streptococcus agalactiae [TaxId:1311] [313977] (1 PDB entry) |
| Domain d5dclb_: 5dcl B: [314517] automated match to d3gt7a_ complexed with edo |
PDB Entry: 5dcl (more details), 1.41 Å
SCOPe Domain Sequences for d5dclb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dclb_ c.23.1.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
eqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpyfng
fywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
Timeline for d5dclb_: