SCOPe 2.08: Domain d5fhal2: 5fha L:107-212

Lineage for d5fhal2 (5fha L:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5fhal2: 5fha L:107-212 [314509]
   Other proteins in same PDB: d5fhah_, d5fhal1
   automated match to d4zykl2

Details for d5fhal2

PDB Entry: 5fha, 1.97 Å

PDB Description: crystal structure of protective ebola virus antibody 114

PDB Compounds: (L:) Antibody 114 Fab light chain

SCOPe Domain Sequences for d5fhal2:

Sequence; same for both SEQRES and ATOM records:

>d5fhal2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5fhal2:

• d5fhal2 first appeared in SCOPe 2.06
  
• d5fhal2 appears in SCOPe 2.07