SCOPe 2.06: Domain d5drob2: 5dro B:128-268

Lineage for d5drob2 (5dro B:128-268)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (17 PDB entries)
   Uniprot O67648 3-270

8. Domain d5drob2: 5dro B:128-268 [314506]
   automated match to d1nzta4
   complexed with act, dms, zh2, zn

Details for d5drob2

PDB Entry: 5dro, 2.01 Å

PDB Description: structure of the aquifex aeolicus lpxc/lpc-011 complex

PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d5drob2:

Sequence; same for both SEQRES and ATOM records:

>d5drob2 d.14.1.7 (B:128-268) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

Timeline for d5drob2:

• d5drob2 is new in SCOPe 2.06-stable
  
• d5drob2 appears in SCOPe 2.07
  
• d5drob2 appears in the current release, SCOPe 2.08