| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins) duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site |
| Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries) Uniprot O67648 3-270 |
| Domain d5drob2: 5dro B:128-268 [314506] automated match to d1nzta4 complexed with act, dms, zh2, zn |
PDB Entry: 5dro (more details), 2.01 Å
SCOPe Domain Sequences for d5drob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5drob2 d.14.1.7 (B:128-268) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk
Timeline for d5drob2: