SCOP 1.65: Domain d1ggeb1: 1gge B:598-753

Lineage for d1ggeb1 (1gge B:598-753)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families)

conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
Protein Catalase, C-terminal domain [52329] (1 species)
Species Escherichia coli, HPII [TaxId:562] [52330] (9 PDB entries)
Domain d1ggeb1: 1gge B:598-753 [31450]
Other proteins in same PDB: d1ggea2, d1ggeb2, d1ggec2, d1gged2

Details for d1ggeb1

PDB Entry: 1gge (more details), 1.89 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, native structure at 1.9 a resolution.

SCOP Domain Sequences for d1ggeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggeb1 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOP Domain Coordinates for d1ggeb1:

Click to download the PDB-style file with coordinates for d1ggeb1.
(The format of our PDB-style files is described here.)

Timeline for d1ggeb1: