Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) |
Protein Catalase, C-terminal domain [52329] (2 species) |
Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries) |
Domain d1ggea1: 1gge A:598-753 [31449] Other proteins in same PDB: d1ggea2, d1ggeb2, d1ggec2, d1gged2 complexed with hdd |
PDB Entry: 1gge (more details), 1.89 Å
SCOPe Domain Sequences for d1ggea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggea1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d1ggea1: