Lineage for d5fpwb_ (5fpw B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174174Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2174175Protein automated matches [190230] (20 species)
    not a true protein
  7. 2174314Species Trypanosoma congolense [TaxId:5692] [314470] (1 PDB entry)
  8. 2174316Domain d5fpwb_: 5fpw B: [314479]
    automated match to d4hwya_

Details for d5fpwb_

PDB Entry: 5fpw (more details), 2.1 Å

PDB Description: procathepsin b s9 from trypanosoma congolense
PDB Compounds: (B:) pro cathepsin b s9

SCOPe Domain Sequences for d5fpwb_:

Sequence, based on SEQRES records: (download)

>d5fpwb_ d.3.1.0 (B:) automated matches {Trypanosoma congolense [TaxId: 5692]}
apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
llscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqgnktpcskynfd
tpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgv
yrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgf
agtpetsq

Sequence, based on observed residues (ATOM records): (download)

>d5fpwb_ d.3.1.0 (B:) automated matches {Trypanosoma congolense [TaxId: 5692]}
apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
llscckqcgggckggfpgfawryyveygiassycqpypfphcenfdtpkcqatctdksip
lvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtav
kvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpetsq

SCOPe Domain Coordinates for d5fpwb_:

Click to download the PDB-style file with coordinates for d5fpwb_.
(The format of our PDB-style files is described here.)

Timeline for d5fpwb_: