Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (23 species) not a true protein |
Species Trypanosoma congolense [TaxId:5692] [314470] (1 PDB entry) |
Domain d5fpwb_: 5fpw B: [314479] automated match to d4hwya_ |
PDB Entry: 5fpw (more details), 2.1 Å
SCOPe Domain Sequences for d5fpwb_:
Sequence, based on SEQRES records: (download)
>d5fpwb_ d.3.1.0 (B:) automated matches {Trypanosoma congolense [TaxId: 5692]} apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah llscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqgnktpcskynfd tpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgv yrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgf agtpetsq
>d5fpwb_ d.3.1.0 (B:) automated matches {Trypanosoma congolense [TaxId: 5692]} apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah llscckqcgggckggfpgfawryyveygiassycqpypfphcenfdtpkcqatctdksip lvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtav kvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpetsq
Timeline for d5fpwb_: