Lineage for d5fpwa_ (5fpw A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498194Species Trypanosoma congolense [TaxId:5692] [314470] (1 PDB entry)
  8. 2498195Domain d5fpwa_: 5fpw A: [314471]
    automated match to d4hwya_

Details for d5fpwa_

PDB Entry: 5fpw (more details), 2.1 Å

PDB Description: procathepsin b s9 from trypanosoma congolense
PDB Compounds: (A:) pro cathepsin b s9

SCOPe Domain Sequences for d5fpwa_:

Sequence, based on SEQRES records: (download)

>d5fpwa_ d.3.1.0 (A:) automated matches {Trypanosoma congolense [TaxId: 5692]}
apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
llscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqgnktpcskynfd
tpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgv
yrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgf
agtpets

Sequence, based on observed residues (ATOM records): (download)

>d5fpwa_ d.3.1.0 (A:) automated matches {Trypanosoma congolense [TaxId: 5692]}
apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
llscckqcgggckggfpgfawryyveygiassycqpypfphcenfdtpkcqatctdksip
lvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtav
kvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpets

SCOPe Domain Coordinates for d5fpwa_:

Click to download the PDB-style file with coordinates for d5fpwa_.
(The format of our PDB-style files is described here.)

Timeline for d5fpwa_: