SCOPe 2.08: Domain d5f96l2: 5f96 L:107-212

Lineage for d5f96l2 (5f96 L:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5f96l2: 5f96 L:107-212 [314450]
   Other proteins in same PDB: d5f96h_, d5f96l1
   automated match to d1dn0a2
   complexed with epe, nag

Details for d5f96l2

PDB Entry: 5f96, 2.24 Å

PDB Description: crystal structure of broadly neutralizing vh1-46 germline-derived cd4- binding site-directed antibody ch235.12 in complex with hiv-1 clade a/e 93th057 gp120

PDB Compounds: (L:) light chain of antibody ch235.12

SCOPe Domain Sequences for d5f96l2:

Sequence; same for both SEQRES and ATOM records:

>d5f96l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5f96l2:

• d5f96l2 first appeared in SCOPe 2.06
  
• d5f96l2 appears in SCOPe 2.07