Lineage for d4yb5e1 (4yb5 E:5-224)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163579Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)
  8. 2163610Domain d4yb5e1: 4yb5 E:5-224 [314433]
    Other proteins in same PDB: d4yb5a2, d4yb5b2, d4yb5c2, d4yb5d2, d4yb5e2, d4yb5f2
    automated match to d1h3da1
    complexed with his, k, peg, pge, scn

Details for d4yb5e1

PDB Entry: 4yb5 (more details), 2.24 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the allosteric inhibitor histidine
PDB Compounds: (E:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb5e1:

Sequence, based on SEQRES records: (download)

>d4yb5e1 c.94.1.0 (E:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqar

Sequence, based on observed residues (ATOM records): (download)

>d4yb5e1 c.94.1.0 (E:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqelkdfeglriat
sypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlkevkviy
esracliqkenalskekqalvdkimlrvagvmqar

SCOPe Domain Coordinates for d4yb5e1:

Click to download the PDB-style file with coordinates for d4yb5e1.
(The format of our PDB-style files is described here.)

Timeline for d4yb5e1: