Lineage for d1cf9c1 (1cf9 C:598-753)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358690Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 1358691Protein Catalase, C-terminal domain [52329] (2 species)
  7. 1358692Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)
  8. 1358707Domain d1cf9c1: 1cf9 C:598-753 [31443]
    Other proteins in same PDB: d1cf9a2, d1cf9b2, d1cf9c2, d1cf9d2
    complexed with hem; mutant

Details for d1cf9c1

PDB Entry: 1cf9 (more details), 1.8 Å

PDB Description: structure of the mutant val169cys of catalase hpii from escherichia coli
PDB Compounds: (C:) protein (catalase hpii)

SCOPe Domain Sequences for d1cf9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf9c1 c.23.16.3 (C:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d1cf9c1:

Click to download the PDB-style file with coordinates for d1cf9c1.
(The format of our PDB-style files is described here.)

Timeline for d1cf9c1: