Lineage for d1g2ic_ (1g2i C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826867Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 826986Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 827056Protein Intracellular protease [52326] (1 species)
  7. 827057Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)
  8. 827060Domain d1g2ic_: 1g2i C: [31440]
    complexed with so4

Details for d1g2ic_

PDB Entry: 1g2i (more details), 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
PDB Compounds: (C:) protease I

SCOP Domain Sequences for d1g2ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ic_ c.23.16.2 (C:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOP Domain Coordinates for d1g2ic_:

Click to download the PDB-style file with coordinates for d1g2ic_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ic_: