SCOP 1.73: Domain d1g2ic_: 1g2i C:

Lineage for d1g2ic_ (1g2i C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Intracellular protease [52326] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)

8. Domain d1g2ic_: 1g2i C: [31440]
   complexed with so4

Details for d1g2ic_

PDB Entry: 1g2i, 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

PDB Compounds: (C:) protease I

SCOP Domain Sequences for d1g2ic_:

Sequence; same for both SEQRES and ATOM records:

>d1g2ic_ c.23.16.2 (C:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

Timeline for d1g2ic_:

• d1g2ic_ first appeared (with stable ids) in SCOP 1.55
  
• d1g2ic_ appears in SCOP 1.71
  
• d1g2ic_ appears in SCOP 1.75
  
• d1g2ic_ appears in the current release, SCOPe 2.08