Lineage for d1g2ic_ (1g2i C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22286Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 22327Family c.23.16.2: Intracellular protease [52325] (1 protein)
  6. 22328Protein Intracellular protease [52326] (1 species)
  7. 22329Species Archaea (Pyrococcus horikoshii) [TaxId:53953] [52327] (1 PDB entry)
  8. 22332Domain d1g2ic_: 1g2i C: [31440]

Details for d1g2ic_

PDB Entry: 1g2i (more details), 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

SCOP Domain Sequences for d1g2ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ic_ c.23.16.2 (C:) Intracellular protease {Archaea (Pyrococcus horikoshii)}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOP Domain Coordinates for d1g2ic_:

Click to download the PDB-style file with coordinates for d1g2ic_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ic_: