![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) ![]() |
![]() | Family c.23.16.2: Intracellular protease [52325] (1 protein) |
![]() | Protein Intracellular protease [52326] (1 species) |
![]() | Species Archaea (Pyrococcus horikoshii) [TaxId:53953] [52327] (1 PDB entry) |
![]() | Domain d1g2ic_: 1g2i C: [31440] |
PDB Entry: 1g2i (more details), 2 Å
SCOP Domain Sequences for d1g2ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ic_ c.23.16.2 (C:) Intracellular protease {Archaea (Pyrococcus horikoshii)} mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
Timeline for d1g2ic_: