Lineage for d5fhoa_ (5fho A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914848Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2914896Domain d5fhoa_: 5fho A: [314387]
    Other proteins in same PDB: d5fhod2
    automated match to d2xhda_
    complexed with 5xn, cl, edo, gol, pg4, so4

Details for d5fhoa_

PDB Entry: 5fho (more details), 2.3 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with (s)-2-amino-3-(5-(2-(3-chlorobenzyl)-2h-tetrazol-5-yl)- 3-hydroxyisoxazol-4-yl)propanoic acid at 2.3 a resolution
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5fhoa_:

Sequence, based on SEQRES records: (download)

>d5fhoa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Sequence, based on observed residues (ATOM records): (download)

>d5fhoa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwec

SCOPe Domain Coordinates for d5fhoa_:

Click to download the PDB-style file with coordinates for d5fhoa_.
(The format of our PDB-style files is described here.)

Timeline for d5fhoa_: