SCOPe 2.08: Domain d5fhoa_: 5fho A:

Lineage for d5fhoa_ (5fho A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d5fhoa_: 5fho A: [314387]
   Other proteins in same PDB: d5fhod2
   automated match to d2xhda_
   complexed with 5xn, cl, edo, gol, pg4, so4

Details for d5fhoa_

PDB Entry: 5fho, 2.3 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with (s)-2-amino-3-(5-(2-(3-chlorobenzyl)-2h-tetrazol-5-yl)- 3-hydroxyisoxazol-4-yl)propanoic acid at 2.3 a resolution

PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5fhoa_:

Sequence, based on SEQRES records:

>d5fhoa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Sequence, based on observed residues (ATOM records):

>d5fhoa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwec

Timeline for d5fhoa_:

• d5fhoa_ first appeared in SCOPe 2.06
  
• d5fhoa_ appears in SCOPe 2.07