Lineage for d1g2ia_ (1g2i A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391660Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 391750Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 391800Protein Intracellular protease [52326] (1 species)
  7. 391801Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry)
  8. 391802Domain d1g2ia_: 1g2i A: [31438]

Details for d1g2ia_

PDB Entry: 1g2i (more details), 2 Å

PDB Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution

SCOP Domain Sequences for d1g2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

SCOP Domain Coordinates for d1g2ia_:

Click to download the PDB-style file with coordinates for d1g2ia_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ia_: