| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein Intracellular protease [52326] (1 species) |
| Species Archaeon Pyrococcus horikoshii [TaxId:53953] [52327] (1 PDB entry) |
| Domain d1g2ia_: 1g2i A: [31438] |
PDB Entry: 1g2i (more details), 2 Å
SCOP Domain Sequences for d1g2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
Timeline for d1g2ia_: