Lineage for d5fhrb_ (5fhr B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145260Protein automated matches [190251] (5 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (9 PDB entries)
  8. 2145278Domain d5fhrb_: 5fhr B: [314347]
    automated match to d2cl5a_
    complexed with br, dnc, mg, sam; mutant

Details for d5fhrb_

PDB Entry: 5fhr (more details), 1.63 Å

PDB Description: crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5fhrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fhrb_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssylelmkvvdglekaiyqgp

SCOPe Domain Coordinates for d5fhrb_:

Click to download the PDB-style file with coordinates for d5fhrb_.
(The format of our PDB-style files is described here.)

Timeline for d5fhrb_: