SCOPe 2.06: Domain d5fhrb_: 5fhr B:

Lineage for d5fhrb_ (5fhr B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein automated matches [190251] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (9 PDB entries)

8. Domain d5fhrb_: 5fhr B: [314347]
   automated match to d2cl5a_
   complexed with br, dnc, mg, sam; mutant

Details for d5fhrb_

PDB Entry: 5fhr, 1.63 Å

PDB Description: crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol

PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5fhrb_:

Sequence; same for both SEQRES and ATOM records:

>d5fhrb_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssylelmkvvdglekaiyqgp

Timeline for d5fhrb_:

• d5fhrb_ is new in SCOPe 2.06-stable
  
• d5fhrb_ appears in SCOPe 2.07
  
• d5fhrb_ appears in the current release, SCOPe 2.08