Lineage for d5eyxb_ (5eyx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779000Species Centrolobium tomentosum [TaxId:500182] [313810] (2 PDB entries)
  8. 2779003Domain d5eyxb_: 5eyx B: [314339]
    automated match to d3zvxb_
    complexed with ca, mn, nag

Details for d5eyxb_

PDB Entry: 5eyx (more details), 2.25 Å

PDB Description: monoclinic form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome.
PDB Compounds: (B:) Centrolobium tomentosum lectin

SCOPe Domain Sequences for d5eyxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyxb_ b.29.1.1 (B:) automated matches {Centrolobium tomentosum [TaxId: 500182]}
sdslsfsfinfdqdernviaqgdarisgnnilqltrtdsdgtpvrstvgrilysaqvrlw
ekstnrvanfqsqfsfflesplsnpadgiaffiappdtaipsgsaggllglfspktaqne
sanqvlavefdtfyaqnsntwdpnyphigidvnsiksaktvrwerregvtlnvlvtynps
tktldvvatypdgqryqisvvvdvttvlpewvrvgfsaasgeqfqthnleswsftstlly

SCOPe Domain Coordinates for d5eyxb_:

Click to download the PDB-style file with coordinates for d5eyxb_.
(The format of our PDB-style files is described here.)

Timeline for d5eyxb_: