Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries) |
Domain d5f99d_: 5f99 D: [314328] Other proteins in same PDB: d5f99b_, d5f99c_, d5f99f_, d5f99g_ automated match to d1s32d_ complexed with cl, mg |
PDB Entry: 5f99 (more details), 2.63 Å
SCOPe Domain Sequences for d5f99d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f99d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]} gkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynk rstitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d5f99d_: