Lineage for d1bxrh2 (1bxr H:153-380)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22286Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 22287Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 protein domains)
  6. 22291Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 22292Species Escherichia coli [TaxId:562] [52322] (7 PDB entries)
  8. 22316Domain d1bxrh2: 1bxr H:153-380 [31432]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrc1, d1bxrc2, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxre1, d1bxre2, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrg1, d1bxrg2, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1

Details for d1bxrh2

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrh2 c.23.16.1 (H:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1bxrh2:

Click to download the PDB-style file with coordinates for d1bxrh2.
(The format of our PDB-style files is described here.)

Timeline for d1bxrh2: