| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (11 PDB entries) |
| Domain d5f99c_: 5f99 C: [314317] Other proteins in same PDB: d5f99d_, d5f99h_ automated match to d1eqza_ complexed with cl, mg |
PDB Entry: 5f99 (more details), 2.63 Å
SCOPe Domain Sequences for d5f99c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f99c_ a.22.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaa
rdnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkte
Timeline for d5f99c_: