SCOPe 2.08: Domain d5eyra2: 5eyr A:95-214

Lineage for d5eyra2 (5eyr A:95-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries)

8. Domain d5eyra2: 5eyr A:95-214 [314298]
   Other proteins in same PDB: d5eyra1
   automated match to d3q0wa2
   complexed with 5t0

Details for d5eyra2

PDB Entry: 5eyr, 1.57 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 5 at 1.57a resolution

PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5eyra2:

Sequence; same for both SEQRES and ATOM records:

>d5eyra2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5eyra2:

• d5eyra2 first appeared in SCOPe 2.06
  
• d5eyra2 appears in SCOPe 2.07