| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [256001] (16 PDB entries) |
| Domain d4y7cb3: 4y7c B:519-678 [314284] Other proteins in same PDB: d4y7ca1, d4y7ca2, d4y7cb1, d4y7cb2 automated match to d1j9za3 complexed with fad, fmn, nap, po4; mutant |
PDB Entry: 4y7c (more details), 2.2 Å
SCOPe Domain Sequences for d4y7cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y7cb3 c.25.1.0 (B:519-678) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldvws
Timeline for d4y7cb3: