Lineage for d4y7cb3 (4y7c B:519-678)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859973Species Norway rat (Rattus norvegicus) [TaxId:10116] [256001] (16 PDB entries)
  8. 2859988Domain d4y7cb3: 4y7c B:519-678 [314284]
    Other proteins in same PDB: d4y7ca1, d4y7ca2, d4y7cb1, d4y7cb2
    automated match to d1j9za3
    complexed with fad, fmn, nap, po4; mutant

Details for d4y7cb3

PDB Entry: 4y7c (more details), 2.2 Å

PDB Description: rat cypor mutant - g141del/e142n
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y7cb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y7cb3 c.25.1.0 (B:519-678) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldvws

SCOPe Domain Coordinates for d4y7cb3:

Click to download the PDB-style file with coordinates for d4y7cb3.
(The format of our PDB-style files is described here.)

Timeline for d4y7cb3: